Recombinant Human CD89 is produced by our Mammalian expression system and the target gene encoding Gln22-Asn227 is expressed with a 6His tag at the C-terminus.

FCAR蛋白；CD89蛋白;Immunoglobulin Alpha Fc Receptor; IgA Fc Receptor; CD89; FCAR

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFV IDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHI PFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVT DSIHQDYTTQNVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Immunoglobulin α Fc Receptor (IgA Fc Receptor) is a member of the immunoglobulin gene superfamily. It is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens through the charged arginin residue within its transmembrane domain. IgA Fc Receptor binds both IgA1 and IgA2 with similar affinity. The site of interaction between FCAR and IgA was identified in the first extracellular domain of FCAR and the C2/C3 junction of IgA. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. FCAR is also expressed on Kupffer cells in the liver, where it was suggested to provide a second line of defense.

P24071